BCAP31 purified MaxPab mouse polyclonal antibody (B01P)
  • BCAP31 purified MaxPab mouse polyclonal antibody (B01P)

BCAP31 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010134-B01P
BCAP31 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BCAP31 protein.
Información adicional
Size 50 ug
Gene Name BCAP31
Gene Alias 6C6-AG|BAP31|CDM|DXS1357E
Gene Description B-cell receptor-associated protein 31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BCAP31 (NP_005736.3, 1 a.a. ~ 246 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10134

Enviar uma mensagem


BCAP31 purified MaxPab mouse polyclonal antibody (B01P)

BCAP31 purified MaxPab mouse polyclonal antibody (B01P)