TRAP1 purified MaxPab mouse polyclonal antibody (B01P)
  • TRAP1 purified MaxPab mouse polyclonal antibody (B01P)

TRAP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010131-B01P
TRAP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRAP1 protein.
Información adicional
Size 50 ug
Gene Name TRAP1
Gene Alias HSP75|HSP90L
Gene Description TNF receptor-associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIII
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRAP1 (NP_057376.1, 1 a.a. ~ 704 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10131

Enviar uma mensagem


TRAP1 purified MaxPab mouse polyclonal antibody (B01P)

TRAP1 purified MaxPab mouse polyclonal antibody (B01P)