PDIA6 monoclonal antibody (M04), clone 3B4
  • PDIA6 monoclonal antibody (M04), clone 3B4

PDIA6 monoclonal antibody (M04), clone 3B4

Ref: AB-H00010130-M04
PDIA6 monoclonal antibody (M04), clone 3B4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PDIA6.
Información adicional
Size 100 ug
Gene Name PDIA6
Gene Alias ERP5|P5|TXNDC7
Gene Description protein disulfide isomerase family A, member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDRNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDIA6 (AAH01312, 1 a.a. ~ 440 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10130
Clone Number 3B4
Iso type IgG2a Kappa

Enviar uma mensagem


PDIA6 monoclonal antibody (M04), clone 3B4

PDIA6 monoclonal antibody (M04), clone 3B4