PDIA6 purified MaxPab mouse polyclonal antibody (B01P)
  • PDIA6 purified MaxPab mouse polyclonal antibody (B01P)

PDIA6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010130-B01P
PDIA6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PDIA6 protein.
Información adicional
Size 50 ug
Gene Name PDIA6
Gene Alias ERP5|P5|TXNDC7
Gene Description protein disulfide isomerase family A, member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDIA6 (NP_005733.1, 1 a.a. ~ 440 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10130

Enviar uma mensagem


PDIA6 purified MaxPab mouse polyclonal antibody (B01P)

PDIA6 purified MaxPab mouse polyclonal antibody (B01P)