View larger
Mouse polyclonal antibody raised against a full-length human ACTR1A protein.
AB-H00010121-B01P
New product
ACTR1A MaxPab mouse polyclonal antibody (B01P)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | ACTR1A |
| Gene Alias | ARP1|CTRN1|FLJ52695|FLJ52800|FLJ55002 |
| Gene Description | ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr |
| Immunogen Prot. Seq | MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSR |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | ACTR1A (NP_005727.1, 1 a.a. ~ 376 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10121 |
More info
Mouse polyclonal antibody raised against a full-length human ACTR1A protein.