KIF20A MaxPab mouse polyclonal antibody (B01)
  • KIF20A MaxPab mouse polyclonal antibody (B01)

KIF20A MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00010112-B01
KIF20A MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIF20A protein.
Información adicional
Size 50 uL
Gene Name KIF20A
Gene Alias FLJ21151|MKLP2|RAB6KIFL
Gene Description kinesin family member 20A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTST
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIF20A (NP_005724.1, 1 a.a. ~ 890 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10112

Enviar uma mensagem


KIF20A MaxPab mouse polyclonal antibody (B01)

KIF20A MaxPab mouse polyclonal antibody (B01)