SGK2 monoclonal antibody (M04), clone 4B12
  • SGK2 monoclonal antibody (M04), clone 4B12

SGK2 monoclonal antibody (M04), clone 4B12

Ref: AB-H00010110-M04
SGK2 monoclonal antibody (M04), clone 4B12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SGK2.
Información adicional
Size 50 ug
Gene Name SGK2
Gene Alias H-SGK2|dJ138B7.2
Gene Description serum/glucocorticoid regulated kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10110
Clone Number 4B12
Iso type IgG1 Kappa

Enviar uma mensagem


SGK2 monoclonal antibody (M04), clone 4B12

SGK2 monoclonal antibody (M04), clone 4B12