CTDSP2 polyclonal antibody (A01)
  • CTDSP2 polyclonal antibody (A01)

CTDSP2 polyclonal antibody (A01)

Ref: AB-H00010106-A01
CTDSP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CTDSP2.
Información adicional
Size 50 uL
Gene Name CTDSP2
Gene Alias OS4|PSR2|SCP2
Gene Description CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTDSP2 (NP_005721, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10106

Enviar uma mensagem


CTDSP2 polyclonal antibody (A01)

CTDSP2 polyclonal antibody (A01)