TSPAN1 polyclonal antibody (A01)
  • TSPAN1 polyclonal antibody (A01)

TSPAN1 polyclonal antibody (A01)

Ref: AB-H00010103-A01
TSPAN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TSPAN1.
Información adicional
Size 50 uL
Gene Name TSPAN1
Gene Alias 9030418M05Rik|NET-1|RP11-322N21.1|TSPAN-1
Gene Description tetraspanin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPAN1 (NP_005718, 110 a.a. ~ 211 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10103

Enviar uma mensagem


TSPAN1 polyclonal antibody (A01)

TSPAN1 polyclonal antibody (A01)