TSFM purified MaxPab mouse polyclonal antibody (B01P)
  • TSFM purified MaxPab mouse polyclonal antibody (B01P)

TSFM purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010102-B01P
TSFM purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TSFM protein.
Información adicional
Size 50 ug
Gene Name TSFM
Gene Alias COXPD3|EF-TS|EF-Tsmt
Gene Description Ts translation elongation factor, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKVQWLTPVNLALWEAEAGGSLEGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSFM (NP_005717.2, 1 a.a. ~ 346 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10102

Enviar uma mensagem


TSFM purified MaxPab mouse polyclonal antibody (B01P)

TSFM purified MaxPab mouse polyclonal antibody (B01P)