ARPC3 monoclonal antibody (M06), clone 2E11
  • ARPC3 monoclonal antibody (M06), clone 2E11

ARPC3 monoclonal antibody (M06), clone 2E11

Ref: AB-H00010094-M06
ARPC3 monoclonal antibody (M06), clone 2E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARPC3.
Información adicional
Size 100 ug
Gene Name ARPC3
Gene Alias ARC21|p21-Arc
Gene Description actin related protein 2/3 complex, subunit 3, 21kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISEC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARPC3 (NP_005710.1, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10094
Clone Number 2E11
Iso type IgG2a Kappa

Enviar uma mensagem


ARPC3 monoclonal antibody (M06), clone 2E11

ARPC3 monoclonal antibody (M06), clone 2E11