ARPC5 polyclonal antibody (A01)
  • ARPC5 polyclonal antibody (A01)

ARPC5 polyclonal antibody (A01)

Ref: AB-H00010092-A01
ARPC5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ARPC5.
Información adicional
Size 50 uL
Gene Name ARPC5
Gene Alias ARC16|MGC88523|dJ127C7.3|p16-Arc
Gene Description actin related protein 2/3 complex, subunit 5, 16kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARPC5 (AAH57237, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10092

Enviar uma mensagem


ARPC5 polyclonal antibody (A01)

ARPC5 polyclonal antibody (A01)