ATP9A monoclonal antibody (M02), clone 3G2
  • ATP9A monoclonal antibody (M02), clone 3G2

ATP9A monoclonal antibody (M02), clone 3G2

Ref: AB-H00010079-M02
ATP9A monoclonal antibody (M02), clone 3G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATP9A.
Información adicional
Size 100 ug
Gene Name ATP9A
Gene Alias ATPIIA|KIAA0611
Gene Description ATPase, class II, type 9A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq YSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTLTTKVRRTMSSRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP9A (NP_006036, 358 a.a. ~ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10079
Clone Number 3G2
Iso type IgG2a Kappa

Enviar uma mensagem


ATP9A monoclonal antibody (M02), clone 3G2

ATP9A monoclonal antibody (M02), clone 3G2