SNUPN purified MaxPab rabbit polyclonal antibody (D01P)
  • SNUPN purified MaxPab rabbit polyclonal antibody (D01P)

SNUPN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010073-D01P
SNUPN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNUPN protein.
Información adicional
Size 100 ug
Gene Name SNUPN
Gene Alias KPNBL|RNUT1|Snurportin1
Gene Description snurportin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNUPN (NP_005692.1, 1 a.a. ~ 360 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10073

Enviar uma mensagem


SNUPN purified MaxPab rabbit polyclonal antibody (D01P)

SNUPN purified MaxPab rabbit polyclonal antibody (D01P)