SCAMP3 monoclonal antibody (M02), clone 3G4
  • SCAMP3 monoclonal antibody (M02), clone 3G4

SCAMP3 monoclonal antibody (M02), clone 3G4

Ref: AB-H00010067-M02
SCAMP3 monoclonal antibody (M02), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCAMP3.
Información adicional
Size 100 ug
Gene Name SCAMP3
Gene Alias C1orf3
Gene Description secretory carrier membrane protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCAMP3 (NP_005689, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10067
Clone Number 3G4
Iso type IgG1 Lambda

Enviar uma mensagem


SCAMP3 monoclonal antibody (M02), clone 3G4

SCAMP3 monoclonal antibody (M02), clone 3G4