SCAMP3 polyclonal antibody (A01)
  • SCAMP3 polyclonal antibody (A01)

SCAMP3 polyclonal antibody (A01)

Ref: AB-H00010067-A01
SCAMP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SCAMP3.
Información adicional
Size 50 uL
Gene Name SCAMP3
Gene Alias C1orf3
Gene Description secretory carrier membrane protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCAMP3 (NP_005689, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10067

Enviar uma mensagem


SCAMP3 polyclonal antibody (A01)

SCAMP3 polyclonal antibody (A01)