COX17 monoclonal antibody (M03), clone 1A9
  • COX17 monoclonal antibody (M03), clone 1A9

COX17 monoclonal antibody (M03), clone 1A9

Ref: AB-H00010063-M03
COX17 monoclonal antibody (M03), clone 1A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COX17.
Información adicional
Size 100 ug
Gene Name COX17
Gene Alias MGC104397|MGC117386
Gene Description COX17 cytochrome c oxidase assembly homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COX17 (NP_005685, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10063
Clone Number 1A9
Iso type IgG2a Kappa

Enviar uma mensagem


COX17 monoclonal antibody (M03), clone 1A9

COX17 monoclonal antibody (M03), clone 1A9