Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ABCF2 MaxPab rabbit polyclonal antibody (D01)
Abnova
ABCF2 MaxPab rabbit polyclonal antibody (D01)
Ref: AB-H00010061-D01
ABCF2 MaxPab rabbit polyclonal antibody (D01)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human ABCF2 protein.
Información adicional
Size
100 uL
Gene Name
ABCF2
Gene Alias
ABC28|DKFZp586K1823|EST133090|HUSSY-18|HUSSY18|M-ABC1
Gene Description
ATP-binding cassette, sub-family F (GCN20), member 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
IP
Immunogen Prot. Seq
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEP
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ABCF2 (NP_009120.1, 1 a.a. ~ 623 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
10061
Enviar uma mensagem
ABCF2 MaxPab rabbit polyclonal antibody (D01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*