ABCF2 MaxPab rabbit polyclonal antibody (D01)
  • ABCF2 MaxPab rabbit polyclonal antibody (D01)

ABCF2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010061-D01
ABCF2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ABCF2 protein.
Información adicional
Size 100 uL
Gene Name ABCF2
Gene Alias ABC28|DKFZp586K1823|EST133090|HUSSY-18|HUSSY18|M-ABC1
Gene Description ATP-binding cassette, sub-family F (GCN20), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ABCF2 (NP_009120.1, 1 a.a. ~ 623 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10061

Enviar uma mensagem


ABCF2 MaxPab rabbit polyclonal antibody (D01)

ABCF2 MaxPab rabbit polyclonal antibody (D01)