SAE1 purified MaxPab mouse polyclonal antibody (B01P)
  • SAE1 purified MaxPab mouse polyclonal antibody (B01P)

SAE1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010055-B01P
SAE1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SAE1 protein.
Información adicional
Size 50 ug
Gene Name SAE1
Gene Alias AOS1|FLJ3091|HSPC140|SUA1
Gene Description SUMO1 activating enzyme subunit 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SAE1 (NP_005491.1, 1 a.a. ~ 346 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10055

Enviar uma mensagem


SAE1 purified MaxPab mouse polyclonal antibody (B01P)

SAE1 purified MaxPab mouse polyclonal antibody (B01P)