SH2D3A monoclonal antibody (M04), clone 3B11
  • SH2D3A monoclonal antibody (M04), clone 3B11

SH2D3A monoclonal antibody (M04), clone 3B11

Ref: AB-H00010045-M04
SH2D3A monoclonal antibody (M04), clone 3B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SH2D3A.
Información adicional
Size 100 ug
Gene Name SH2D3A
Gene Alias NSP1
Gene Description SH2 domain containing 3A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq GAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFVRRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH2D3A (NP_005481, 460 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10045
Clone Number 3B11
Iso type IgG2a Kappa

Enviar uma mensagem


SH2D3A monoclonal antibody (M04), clone 3B11

SH2D3A monoclonal antibody (M04), clone 3B11