SH2D3C purified MaxPab rabbit polyclonal antibody (D01P)
  • SH2D3C purified MaxPab rabbit polyclonal antibody (D01P)

SH2D3C purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010044-D01P
SH2D3C purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SH2D3C protein.
Información adicional
Size 100 ug
Gene Name SH2D3C
Gene Alias CHAT|FLJ39664|NSP3|PRO34088
Gene Description SH2 domain containing 3C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYHVGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRSVTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLHSPMSPISE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SH2D3C (AAH27962.1, 1 a.a. ~ 703 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10044

Enviar uma mensagem


SH2D3C purified MaxPab rabbit polyclonal antibody (D01P)

SH2D3C purified MaxPab rabbit polyclonal antibody (D01P)