SH2D3C polyclonal antibody (A01)
  • SH2D3C polyclonal antibody (A01)

SH2D3C polyclonal antibody (A01)

Ref: AB-H00010044-A01
SH2D3C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SH2D3C.
Información adicional
Size 50 uL
Gene Name SH2D3C
Gene Alias CHAT|FLJ39664|NSP3|PRO34088
Gene Description SH2 domain containing 3C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH2D3C (NP_005480, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10044

Enviar uma mensagem


SH2D3C polyclonal antibody (A01)

SH2D3C polyclonal antibody (A01)