TOM1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TOM1 purified MaxPab rabbit polyclonal antibody (D01P)

TOM1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010043-D01P
TOM1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TOM1 protein.
Información adicional
Size 100 ug
Gene Name TOM1
Gene Alias FLJ33404
Gene Description target of myb1 (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOM1 (NP_005479.1, 1 a.a. ~ 492 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10043

Enviar uma mensagem


TOM1 purified MaxPab rabbit polyclonal antibody (D01P)

TOM1 purified MaxPab rabbit polyclonal antibody (D01P)