TOM1 MaxPab mouse polyclonal antibody (B01)
  • TOM1 MaxPab mouse polyclonal antibody (B01)

TOM1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00010043-B01
TOM1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TOM1 protein.
Información adicional
Size 50 uL
Gene Name TOM1
Gene Alias FLJ33404
Gene Description target of myb1 (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOM1 (NP_005479.1, 1 a.a. ~ 492 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10043

Enviar uma mensagem


TOM1 MaxPab mouse polyclonal antibody (B01)

TOM1 MaxPab mouse polyclonal antibody (B01)