HMG2L1 monoclonal antibody (M03), clone 3C12
  • HMG2L1 monoclonal antibody (M03), clone 3C12

HMG2L1 monoclonal antibody (M03), clone 3C12

Ref: AB-H00010042-M03
HMG2L1 monoclonal antibody (M03), clone 3C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HMG2L1.
Información adicional
Size 100 ug
Gene Name HMGXB4
Gene Alias HMG2L1|HMGBCG|THC211630
Gene Description HMG box domain containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMG2L1 (NP_001003681, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10042
Clone Number 3C12
Iso type IgG1 Kappa

Enviar uma mensagem


HMG2L1 monoclonal antibody (M03), clone 3C12

HMG2L1 monoclonal antibody (M03), clone 3C12