THRAP5 monoclonal antibody (M03), clone 3B10
  • THRAP5 monoclonal antibody (M03), clone 3B10

THRAP5 monoclonal antibody (M03), clone 3B10

Ref: AB-H00010025-M03
THRAP5 monoclonal antibody (M03), clone 3B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant THRAP5.
Información adicional
Size 100 ug
Gene Name MED16
Gene Alias DRIP92|THRAP5|TRAP95
Gene Description mediator complex subunit 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THRAP5 (AAH17282, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10025
Clone Number 3B10
Iso type IgG2a Kappa

Enviar uma mensagem


THRAP5 monoclonal antibody (M03), clone 3B10

THRAP5 monoclonal antibody (M03), clone 3B10