HCN4 monoclonal antibody (M04), clone 2A5
  • HCN4 monoclonal antibody (M04), clone 2A5

HCN4 monoclonal antibody (M04), clone 2A5

Ref: AB-H00010021-M04
HCN4 monoclonal antibody (M04), clone 2A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HCN4.
Información adicional
Size 100 ug
Gene Name HCN4
Gene Alias -
Gene Description hyperpolarization activated cyclic nucleotide-gated potassium channel 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLPSNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HCN4 (NP_005468.1, 1105 a.a. ~ 1203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10021
Clone Number 2A5
Iso type IgG2a Kappa

Enviar uma mensagem


HCN4 monoclonal antibody (M04), clone 2A5

HCN4 monoclonal antibody (M04), clone 2A5