GNE polyclonal antibody (A01)
  • GNE polyclonal antibody (A01)

GNE polyclonal antibody (A01)

Ref: AB-H00010020-A01
GNE polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GNE.
Información adicional
Size 50 uL
Gene Name GNE
Gene Alias DMRV|GLCNE|IBM2|NM|Uae1
Gene Description glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDYGNTYRMIEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNE (NP_005467, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10020

Enviar uma mensagem


GNE polyclonal antibody (A01)

GNE polyclonal antibody (A01)