BCL2L10 polyclonal antibody (A01)
  • BCL2L10 polyclonal antibody (A01)

BCL2L10 polyclonal antibody (A01)

Ref: AB-H00010017-A01
BCL2L10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCL2L10.
Información adicional
Size 50 uL
Gene Name BCL2L10
Gene Alias BCL-B|Boo|Diva|MGC129810|MGC129811
Gene Description BCL2-like 10 (apoptosis facilitator)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCL2L10 (NP_065129, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10017

Enviar uma mensagem


BCL2L10 polyclonal antibody (A01)

BCL2L10 polyclonal antibody (A01)