PDCD6IP MaxPab rabbit polyclonal antibody (D01)
  • PDCD6IP MaxPab rabbit polyclonal antibody (D01)

PDCD6IP MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010015-D01
PDCD6IP MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDCD6IP protein.
Información adicional
Size 100 uL
Gene Name PDCD6IP
Gene Alias AIP1|Alix|DRIP4|HP95|MGC17003
Gene Description programmed cell death 6 interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQAN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDCD6IP (AAH20066.1, 1 a.a. ~ 868 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10015

Enviar uma mensagem


PDCD6IP MaxPab rabbit polyclonal antibody (D01)

PDCD6IP MaxPab rabbit polyclonal antibody (D01)