HDAC6 polyclonal antibody (A01)
  • HDAC6 polyclonal antibody (A01)

HDAC6 polyclonal antibody (A01)

Ref: AB-H00010013-A01
HDAC6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HDAC6.
Información adicional
Size 50 uL
Gene Name HDAC6
Gene Alias FLJ16239|HD6|JM21
Gene Description histone deacetylase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HDAC6 (NP_006035, 1128 a.a. ~ 1215 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10013

Enviar uma mensagem


HDAC6 polyclonal antibody (A01)

HDAC6 polyclonal antibody (A01)