TANK purified MaxPab rabbit polyclonal antibody (D01P)
  • TANK purified MaxPab rabbit polyclonal antibody (D01P)

TANK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010010-D01P
TANK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TANK protein.
Información adicional
Size 100 ug
Gene Name TANK
Gene Alias I-TRAF|TRAF2
Gene Description TRAF family member-associated NFKB activator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TANK (NP_597841.1, 1 a.a. ~ 119 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10010

Enviar uma mensagem


TANK purified MaxPab rabbit polyclonal antibody (D01P)

TANK purified MaxPab rabbit polyclonal antibody (D01P)