Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZBTB33 monoclonal antibody (M01A), clone 2B2
Abnova
ZBTB33 monoclonal antibody (M01A), clone 2B2
Ref: AB-H00010009-M01A
ZBTB33 monoclonal antibody (M01A), clone 2B2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZBTB33.
Información adicional
Size
200 uL
Gene Name
ZBTB33
Gene Alias
ZNF-kaiso|ZNF348
Gene Description
zinc finger and BTB domain containing 33
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq
QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZBTB33 (AAH42753, 564 a.a. ~ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In ascites fluid
Gene ID
10009
Clone Number
2B2
Iso type
IgG2a Kappa
Enviar uma mensagem
ZBTB33 monoclonal antibody (M01A), clone 2B2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*