Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ACOT8 monoclonal antibody (M03), clone 3F1
Abnova
ACOT8 monoclonal antibody (M03), clone 3F1
Ref: AB-H00010005-M03
ACOT8 monoclonal antibody (M03), clone 3F1
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ACOT8.
Información adicional
Size
100 ug
Gene Name
ACOT8
Gene Alias
HNAACTE|PTE-2|PTE1|PTE2|hACTE-III|hTE
Gene Description
acyl-CoA thioesterase 8
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
SVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYI
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACOT8 (NP_005460.2, 108 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10005
Clone Number
3F1
Iso type
IgG1 Kappa
Enviar uma mensagem
ACOT8 monoclonal antibody (M03), clone 3F1
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*