Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AKT3 monoclonal antibody (M06), clone 2H4
Abnova
AKT3 monoclonal antibody (M06), clone 2H4
Ref: AB-H00010000-M06
AKT3 monoclonal antibody (M06), clone 2H4
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AKT3.
Información adicional
Size
100 ug
Gene Name
AKT3
Gene Alias
DKFZp434N0250|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2
Gene Description
v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10000
Clone Number
2H4
Iso type
IgG2a Kappa
Enviar uma mensagem
AKT3 monoclonal antibody (M06), clone 2H4
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*