AKT3 monoclonal antibody (M06), clone 2H4
  • AKT3 monoclonal antibody (M06), clone 2H4

AKT3 monoclonal antibody (M06), clone 2H4

Ref: AB-H00010000-M06
AKT3 monoclonal antibody (M06), clone 2H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AKT3.
Información adicional
Size 100 ug
Gene Name AKT3
Gene Alias DKFZp434N0250|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2
Gene Description v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10000
Clone Number 2H4
Iso type IgG2a Kappa

Enviar uma mensagem


AKT3 monoclonal antibody (M06), clone 2H4

AKT3 monoclonal antibody (M06), clone 2H4