KCNE2 polyclonal antibody (A01)
  • KCNE2 polyclonal antibody (A01)

KCNE2 polyclonal antibody (A01)

Ref: AB-H00009992-A01
KCNE2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KCNE2.
Información adicional
Size 50 uL
Gene Name KCNE2
Gene Alias LQT5|LQT6|MGC138292|MIRP1
Gene Description potassium voltage-gated channel, Isk-related family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNE2 (NP_751951, 73 a.a. ~ 123 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9992

Enviar uma mensagem


KCNE2 polyclonal antibody (A01)

KCNE2 polyclonal antibody (A01)