REC8 monoclonal antibody (M01), clone 2G3
  • REC8 monoclonal antibody (M01), clone 2G3

REC8 monoclonal antibody (M01), clone 2G3

Ref: AB-H00009985-M01
REC8 monoclonal antibody (M01), clone 2G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant REC8.
Información adicional
Size 100 ug
Gene Name REC8
Gene Alias HR21spB|MGC950|REC8L1|Rec8p
Gene Description REC8 homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGLPRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen REC8 (AAH04159.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9985
Clone Number 2G3
Iso type IgG2a Kappa

Enviar uma mensagem


REC8 monoclonal antibody (M01), clone 2G3

REC8 monoclonal antibody (M01), clone 2G3