TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)
  • TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)

TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009966-D01P
TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TNFSF15 protein.
Información adicional
Size 100 ug
Gene Name TNFSF15
Gene Alias MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A
Gene Description tumor necrosis factor (ligand) superfamily, member 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFSF15 (NP_005109.2, 1 a.a. ~ 251 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9966

Enviar uma mensagem


TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)

TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)