USP3 purified MaxPab mouse polyclonal antibody (B01P)
  • USP3 purified MaxPab mouse polyclonal antibody (B01P)

USP3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009960-B01P
USP3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human USP3 protein.
Información adicional
Size 50 ug
Gene Name USP3
Gene Alias MGC129878|MGC129879|SIH003|UBP
Gene Description ubiquitin specific peptidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP3 (NP_006528.2, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9960

Enviar uma mensagem


USP3 purified MaxPab mouse polyclonal antibody (B01P)

USP3 purified MaxPab mouse polyclonal antibody (B01P)