USP3 polyclonal antibody (A01)
  • USP3 polyclonal antibody (A01)

USP3 polyclonal antibody (A01)

Ref: AB-H00009960-A01
USP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP3.
Información adicional
Size 50 uL
Gene Name USP3
Gene Alias MGC129878|MGC129879|SIH003|UBP
Gene Description ubiquitin specific peptidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP3 (NP_006528, 421 a.a. ~ 520 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9960

Enviar uma mensagem


USP3 polyclonal antibody (A01)

USP3 polyclonal antibody (A01)