HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)
  • HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)

HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009957-B01P
HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HS3ST1 protein.
Información adicional
Size 50 ug
Gene Name HS3ST1
Gene Alias 3OST|3OST1
Gene Description heparan sulfate (glucosamine) 3-O-sulfotransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HS3ST1 (NP_005105.1, 1 a.a. ~ 307 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9957

Enviar uma mensagem


HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)

HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)