OXSR1 polyclonal antibody (A01)
  • OXSR1 polyclonal antibody (A01)

OXSR1 polyclonal antibody (A01)

Ref: AB-H00009943-A01
OXSR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant OXSR1.
Información adicional
Size 50 uL
Gene Name OXSR1
Gene Alias KIAA1101|OSR1
Gene Description oxidative-stress responsive 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9943

Enviar uma mensagem


OXSR1 polyclonal antibody (A01)

OXSR1 polyclonal antibody (A01)