XYLB purified MaxPab mouse polyclonal antibody (B01P)
  • XYLB purified MaxPab mouse polyclonal antibody (B01P)

XYLB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009942-B01P
XYLB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human XYLB protein.
Información adicional
Size 50 ug
Gene Name XYLB
Gene Alias FLJ10343|FLJ12539|FLJ22075
Gene Description xylulokinase homolog (H. influenzae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen XYLB (NP_005099.2, 1 a.a. ~ 536 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9942

Enviar uma mensagem


XYLB purified MaxPab mouse polyclonal antibody (B01P)

XYLB purified MaxPab mouse polyclonal antibody (B01P)