Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
XYLB purified MaxPab mouse polyclonal antibody (B01P)
Abnova
XYLB purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00009942-B01P
XYLB purified MaxPab mouse polyclonal antibody (B01P)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length human XYLB protein.
Información adicional
Size
50 ug
Gene Name
XYLB
Gene Alias
FLJ10343|FLJ12539|FLJ22075
Gene Description
xylulokinase homolog (H. influenzae)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVV
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
XYLB (NP_005099.2, 1 a.a. ~ 536 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
9942
Enviar uma mensagem
XYLB purified MaxPab mouse polyclonal antibody (B01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*