ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)
  • ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)

ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009938-B01P
ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARHGAP25 protein.
Información adicional
Size 50 ug
Gene Name ARHGAP25
Gene Alias KAIA0053
Gene Description Rho GTPase activating protein 25
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARHGAP25 (AAH39591.1, 1 a.a. ~ 458 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9938

Enviar uma mensagem


ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)

ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)