HELZ monoclonal antibody (M02), clone 5B2
  • HELZ monoclonal antibody (M02), clone 5B2

HELZ monoclonal antibody (M02), clone 5B2

Ref: AB-H00009931-M02
HELZ monoclonal antibody (M02), clone 5B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HELZ.
Información adicional
Size 100 ug
Gene Name HELZ
Gene Alias DHRC|DKFZp586G1924|DRHC|HUMORF5|KIAA0054|MGC163454
Gene Description helicase with zinc finger
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HELZ (NP_055692, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9931
Clone Number 5B2
Iso type IgG2b Kappa

Enviar uma mensagem


HELZ monoclonal antibody (M02), clone 5B2

HELZ monoclonal antibody (M02), clone 5B2