KIF14 MaxPab mouse polyclonal antibody (B01P)
  • KIF14 MaxPab mouse polyclonal antibody (B01P)

KIF14 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009928-B01P
KIF14 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIF14 protein.
Información adicional
Size 50 ug
Gene Name KIF14
Gene Alias KIAA0042|MGC142302
Gene Description kinesin family member 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSLHSTHNRNNSGDILDIPSSQNSSSLNALTHSSRLKLHLKSDMSECENDDPLLRSAGKVRDINRTYVISASRKTADMPLTPNPVGRLALQRRTTRNKESSLLVSELEDTTEKTAETRLTLQRRAKTDSAEKWKTAEIDSVKMTLNVGGETENNGVSKESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENVALKYSSNRPPIASLSQTEVVRSGHLTTKPTQSKLDIKVLGTGNLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIF14 (NP_055690.1, 1 a.a. ~ 1648 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9928

Enviar uma mensagem


KIF14 MaxPab mouse polyclonal antibody (B01P)

KIF14 MaxPab mouse polyclonal antibody (B01P)