LPGAT1 purified MaxPab mouse polyclonal antibody (B01P)
  • LPGAT1 purified MaxPab mouse polyclonal antibody (B01P)

LPGAT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009926-B01P
LPGAT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LPGAT1 protein.
Información adicional
Size 50 ug
Gene Name LPGAT1
Gene Alias FAM34A|FAM34A1|NET8
Gene Description lysophosphatidylglycerol acyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LPGAT1 (NP_055688.1, 1 a.a. ~ 370 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9926

Enviar uma mensagem


LPGAT1 purified MaxPab mouse polyclonal antibody (B01P)

LPGAT1 purified MaxPab mouse polyclonal antibody (B01P)