RNF10 purified MaxPab mouse polyclonal antibody (B02P)
  • RNF10 purified MaxPab mouse polyclonal antibody (B02P)

RNF10 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00009921-B02P
RNF10 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RNF10 protein.
Información adicional
Size 50 ug
Gene Name RNF10
Gene Alias KIAA0262|MGC126758|MGC126764|RIE2
Gene Description ring finger protein 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPLSSPNAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSSGSKRYNRKRELSYPKNESFNNQSRRSSSQKSKTFNKMPPQRGGGSSKLFSSSFNGGRRDEVAEAQRAEFSPAQFSGPKKINLNHLLNFTFEPRGQTGHFEGSGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNF10 (NP_055683.3, 1 a.a. ~ 811 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9921

Enviar uma mensagem


RNF10 purified MaxPab mouse polyclonal antibody (B02P)

RNF10 purified MaxPab mouse polyclonal antibody (B02P)