CNAP1 monoclonal antibody (M02), clone 4C9
  • CNAP1 monoclonal antibody (M02), clone 4C9

CNAP1 monoclonal antibody (M02), clone 4C9

Ref: AB-H00009918-M02
CNAP1 monoclonal antibody (M02), clone 4C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CNAP1.
Información adicional
Size 100 ug
Gene Name NCAPD2
Gene Alias CAP-D2|CNAP1|KIAA0159|hCAP-D2
Gene Description non-SMC condensin I complex, subunit D2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNAP1 (AAH28182, 1240 a.a. ~ 1339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9918
Clone Number 4C9
Iso type IgG1 Kappa

Enviar uma mensagem


CNAP1 monoclonal antibody (M02), clone 4C9

CNAP1 monoclonal antibody (M02), clone 4C9