RABGAP1L monoclonal antibody (M05), clone 2D3
  • RABGAP1L monoclonal antibody (M05), clone 2D3

RABGAP1L monoclonal antibody (M05), clone 2D3

Ref: AB-H00009910-M05
RABGAP1L monoclonal antibody (M05), clone 2D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RABGAP1L.
Información adicional
Size 100 ug
Gene Name RABGAP1L
Gene Alias DKFZp686E1450|HHL|TBC1D18
Gene Description RAB GTPase activating protein 1-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MEVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLEKAMEEILRDSEKRPSSLLVDCQSSSEISDHSFGDIPASQTNKPSLQLILDPSNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RABGAP1L (NP_055672.3, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9910
Clone Number 2D3
Iso type IgG1 Kappa

Enviar uma mensagem


RABGAP1L monoclonal antibody (M05), clone 2D3

RABGAP1L monoclonal antibody (M05), clone 2D3